Host taxon 9606
Protein NP_054769.1
39S ribosomal protein L42, mitochondrial precursor
Homo sapiens
Gene MRPL42, UniProt Q9Y6G3
>NP_054769.1|Haemophilus ducreyi 35000HP|39S ribosomal protein L42, mitochondrial precursor
MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.47 | -0.474229811069572 | 0.0079 | 31213562 | |
Retrieved 1 of 2 entries in 2.2 ms
(Link to these results)