Host taxon 9606
Protein NP_057588.1
39S ribosomal protein L27, mitochondrial
Homo sapiens
Gene MRPL27, UniProt Q9P0M9
>NP_057588.1|Haemophilus ducreyi 35000HP|39S ribosomal protein L27, mitochondrial
MASVVLALRTRTAVTSLLSPTPATALAVRYASKKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.78 | 0.779765460177001 | 0.0024 | 31213562 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)