Host taxon 9606
Protein NP_001287777.1
39S ribosomal protein L2, mitochondrial isoform 2
Homo sapiens
Gene MRPL2, UniProt Q5T653
>NP_001287777.1|Haemophilus ducreyi 35000HP|39S ribosomal protein L2, mitochondrial isoform 2
MALCALTRALRSLNLAPPTVAAPAPSLFPAAQMMNNGLLQQPSALMLLPCRPVLTSVALNANFVSWKSRTKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDPCRSADIALVAGGSRKRWIIATENMQAGDTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGAGNVRSNSRPSIQR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.4 | 0.40215337379295 | 0.044 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)