Host taxon 9606
Protein NP_057055.2
28S ribosomal protein S7, mitochondrial
Homo sapiens
Gene MRPS7, UniProt Q9Y2R9
>NP_057055.2|Haemophilus ducreyi 35000HP|28S ribosomal protein S7, mitochondrial
MAAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYRWW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.99 | 0.987146215897834 | 0.0007 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)