Host taxon 9606
Protein NP_071942.1
28S ribosomal protein S25, mitochondrial
Homo sapiens
Gene MRPS25, UniProt P82663
>NP_071942.1|Haemophilus ducreyi 35000HP|28S ribosomal protein S25, mitochondrial
MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.39 | -0.388720876481202 | 0.024 | 31213562 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)