Host taxon 9606
Protein NP_001308899.1
28S ribosomal protein S11, mitochondrial isoform c
Homo sapiens
Gene MRPS11, UniProt P82912
>NP_001308899.1|Haemophilus ducreyi 35000HP|28S ribosomal protein S11, mitochondrial isoform c
MQAVRNAGSRFLRSWTWPQTAGVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.41 | 0.413332815235892 | 0.0018 | 31213562 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)