Host taxon 9606
Protein NP_002148.1
10 kDa heat shock protein, mitochondrial
Homo sapiens
Gene HSPE1, UniProt P61604
>NP_002148.1|Haemophilus ducreyi 35000HP|10 kDa heat shock protein, mitochondrial
MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.18 | 1.18335414262465 | 0.0012 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)